Protein Description: carbohydrate sulfotransferase 13
Gene Name: CHST13
Alternative Gene Name: C4ST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056643: 77%, ENSRNOG00000025930: 73%
Entrez Gene ID: 166012
Uniprot ID: Q8NET6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHST13
Alternative Gene Name: C4ST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056643: 77%, ENSRNOG00000025930: 73%
Entrez Gene ID: 166012
Uniprot ID: Q8NET6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY |
| Documents & Links for Anti CHST13 pAb (ATL-HPA067960) | |
| Datasheet | Anti CHST13 pAb (ATL-HPA067960) Datasheet (External Link) |
| Vendor Page | Anti CHST13 pAb (ATL-HPA067960) at Atlas |
| Documents & Links for Anti CHST13 pAb (ATL-HPA067960) | |
| Datasheet | Anti CHST13 pAb (ATL-HPA067960) Datasheet (External Link) |
| Vendor Page | Anti CHST13 pAb (ATL-HPA067960) |