Protein Description: cholinergic receptor, nicotinic, alpha 5 (neuronal)
Gene Name: CHRNA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035594: 74%, ENSRNOG00000013610: 74%
Entrez Gene ID: 1138
Uniprot ID: P30532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHRNA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035594: 74%, ENSRNOG00000013610: 74%
Entrez Gene ID: 1138
Uniprot ID: P30532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK |
| Documents & Links for Anti CHRNA5 pAb (ATL-HPA054381) | |
| Datasheet | Anti CHRNA5 pAb (ATL-HPA054381) Datasheet (External Link) |
| Vendor Page | Anti CHRNA5 pAb (ATL-HPA054381) at Atlas |
| Documents & Links for Anti CHRNA5 pAb (ATL-HPA054381) | |
| Datasheet | Anti CHRNA5 pAb (ATL-HPA054381) Datasheet (External Link) |
| Vendor Page | Anti CHRNA5 pAb (ATL-HPA054381) |