Anti CHRDL2 pAb (ATL-HPA076522)

Atlas Antibodies

Catalog No: ATL-HPA076522-25

• 

Product Description

Protein Description: chordin like 2
Gene Name: CHRDL2
Alternative Gene Name: BNF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030732: 74%, ENSRNOG00000018394: 74%
Entrez Gene ID: 25884
Uniprot ID: Q6WN34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPK
• Gene Sequence: VWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPK
• Gene ID - Mouse: ENSMUSG00000030732
• Gene ID - Rat: ENSRNOG00000018394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.