Protein Description: chordin like 2
Gene Name: CHRDL2
Alternative Gene Name: BNF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030732: 74%, ENSRNOG00000018394: 74%
Entrez Gene ID: 25884
Uniprot ID: Q6WN34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHRDL2
Alternative Gene Name: BNF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030732: 74%, ENSRNOG00000018394: 74%
Entrez Gene ID: 25884
Uniprot ID: Q6WN34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPK |
Documents & Links for Anti CHRDL2 pAb (ATL-HPA076522) | |
Datasheet | Anti CHRDL2 pAb (ATL-HPA076522) Datasheet (External Link) |
Vendor Page | Anti CHRDL2 pAb (ATL-HPA076522) at Atlas |
Documents & Links for Anti CHRDL2 pAb (ATL-HPA076522) | |
Datasheet | Anti CHRDL2 pAb (ATL-HPA076522) Datasheet (External Link) |
Vendor Page | Anti CHRDL2 pAb (ATL-HPA076522) |