Anti CHRAC1 pAb (ATL-HPA059008)

Atlas Antibodies

Catalog No: ATL-HPA059008-25

• 

Product Description

Protein Description: chromatin accessibility complex 1
Gene Name: CHRAC1
Alternative Gene Name: CHRAC15, YCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068391: 88%, ENSRNOG00000009103: 93%
Entrez Gene ID: 54108
Uniprot ID: Q9NRG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCL
• Gene Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCL
• Gene ID - Mouse: ENSMUSG00000068391
• Gene ID - Rat: ENSRNOG00000009103
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.