Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056437-25

• 
• 

Product Description

Protein Description: charged multivesicular body protein 5
Gene Name: CHMP5
Alternative Gene Name: C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028419: 96%, ENSRNOG00000008672: 96%
Entrez Gene ID: 51510
Uniprot ID: Q9NZZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
• Gene Sequence: KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
• Gene ID - Mouse: ENSMUSG00000028419
• Gene ID - Rat: ENSRNOG00000008672
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.