Description
Product Description
Protein Description: charged multivesicular body protein 3
Gene Name: CHMP3
Alternative Gene Name: CGI-149, NEDF, VPS24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053119: 97%, ENSRNOG00000007356: 97%
Entrez Gene ID: 51652
Uniprot ID: Q9Y3E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHMP3
Alternative Gene Name: CGI-149, NEDF, VPS24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053119: 97%, ENSRNOG00000007356: 97%
Entrez Gene ID: 51652
Uniprot ID: Q9Y3E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA |
Gene Sequence | VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA |
Gene ID - Mouse | ENSMUSG00000053119 |
Gene ID - Rat | ENSRNOG00000007356 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CHMP3 pAb (ATL-HPA073383) | |
Datasheet | Anti CHMP3 pAb (ATL-HPA073383) Datasheet (External Link) |
Vendor Page | Anti CHMP3 pAb (ATL-HPA073383) at Atlas Antibodies |
Documents & Links for Anti CHMP3 pAb (ATL-HPA073383) | |
Datasheet | Anti CHMP3 pAb (ATL-HPA073383) Datasheet (External Link) |
Vendor Page | Anti CHMP3 pAb (ATL-HPA073383) |