Description
Product Description
Protein Description: choroideremia-like (Rab escort protein 2)
Gene Name: CHML
Alternative Gene Name: REP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078185: 60%, ENSRNOG00000005733: 33%
Entrez Gene ID: 1122
Uniprot ID: P26374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHML
Alternative Gene Name: REP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078185: 60%, ENSRNOG00000005733: 33%
Entrez Gene ID: 1122
Uniprot ID: P26374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY |
Gene Sequence | LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY |
Gene ID - Mouse | ENSMUSG00000078185 |
Gene ID - Rat | ENSRNOG00000005733 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CHML pAb (ATL-HPA062967) | |
Datasheet | Anti CHML pAb (ATL-HPA062967) Datasheet (External Link) |
Vendor Page | Anti CHML pAb (ATL-HPA062967) at Atlas Antibodies |
Documents & Links for Anti CHML pAb (ATL-HPA062967) | |
Datasheet | Anti CHML pAb (ATL-HPA062967) Datasheet (External Link) |
Vendor Page | Anti CHML pAb (ATL-HPA062967) |