Anti CHL1 pAb (ATL-HPA003345)

Catalog No:
ATL-HPA003345-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: cell adhesion molecule L1-like
Gene Name: CHL1
Alternative Gene Name: CALL, FLJ44930, L1CAM2, MGC132578
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030077: 79%, ENSRNOG00000045771: 74%
Entrez Gene ID: 10752
Uniprot ID: O00533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence CEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCS

Documents & Links for Anti CHL1 pAb (ATL-HPA003345)
Datasheet Anti CHL1 pAb (ATL-HPA003345) Datasheet (External Link)
Vendor Page Anti CHL1 pAb (ATL-HPA003345) at Atlas

Documents & Links for Anti CHL1 pAb (ATL-HPA003345)
Datasheet Anti CHL1 pAb (ATL-HPA003345) Datasheet (External Link)
Vendor Page Anti CHL1 pAb (ATL-HPA003345)

Citations for Anti CHL1 pAb (ATL-HPA003345) – 2 Found
Remnestål, Julia; Öijerstedt, Linn; Ullgren, Abbe; Olofsson, Jennie; Bergström, Sofia; Kultima, Kim; Ingelsson, Martin; Kilander, Lena; Uhlén, Mathias; Månberg, Anna; Graff, Caroline; Nilsson, Peter. Altered levels of CSF proteins in patients with FTD, presymptomatic mutation carriers and non-carriers. Translational Neurodegeneration. 2020;9(1):27.  PubMed
Remnestål, Julia; Bergström, Sofia; Olofsson, Jennie; Sjöstedt, Evelina; Uhlén, Mathias; Blennow, Kaj; Zetterberg, Henrik; Zettergren, Anna; Kern, Silke; Skoog, Ingmar; Nilsson, Peter; Månberg, Anna. Association of CSF proteins with tau and amyloid β levels in asymptomatic 70-year-olds. Alzheimer's Research & Therapy. 2021;13(1):54.  PubMed