Protein Description: chitinase 3 like 1
Gene Name: CHI3L1
Alternative Gene Name: GP39, YKL40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064246: 76%, ENSRNOG00000053272: 79%
Entrez Gene ID: 1116
Uniprot ID: P36222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHI3L1
Alternative Gene Name: GP39, YKL40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064246: 76%, ENSRNOG00000053272: 79%
Entrez Gene ID: 1116
Uniprot ID: P36222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL |
| Documents & Links for Anti CHI3L1 pAb (ATL-HPA077365) | |
| Datasheet | Anti CHI3L1 pAb (ATL-HPA077365) Datasheet (External Link) |
| Vendor Page | Anti CHI3L1 pAb (ATL-HPA077365) at Atlas |
| Documents & Links for Anti CHI3L1 pAb (ATL-HPA077365) | |
| Datasheet | Anti CHI3L1 pAb (ATL-HPA077365) Datasheet (External Link) |
| Vendor Page | Anti CHI3L1 pAb (ATL-HPA077365) |