Anti CHGA pAb (ATL-HPA017369 w/enhanced validation)

Catalog No:
ATL-HPA017369-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: chromogranin A (parathyroid secretory protein 1)
Gene Name: CHGA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021194: 62%, ENSRNOG00000052549: 64%
Entrez Gene ID: 1113
Uniprot ID: P10645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK

Documents & Links for Anti CHGA pAb (ATL-HPA017369 w/enhanced validation)
Datasheet Anti CHGA pAb (ATL-HPA017369 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHGA pAb (ATL-HPA017369 w/enhanced validation) at Atlas

Documents & Links for Anti CHGA pAb (ATL-HPA017369 w/enhanced validation)
Datasheet Anti CHGA pAb (ATL-HPA017369 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHGA pAb (ATL-HPA017369 w/enhanced validation)

Citations for Anti CHGA pAb (ATL-HPA017369 w/enhanced validation) – 5 Found
Chen, Huanhuan Joyce; Wei, Zhubo; Sun, Jian; Bhattacharya, Asmita; Savage, David J; Serda, Rita; Mackeyev, Yuri; Curley, Steven A; Bu, Pengcheng; Wang, Lihua; Chen, Shuibing; Cohen-Gould, Leona; Huang, Emina; Shen, Xiling; Lipkin, Steven M; Copeland, Neal G; Jenkins, Nancy A; Shuler, Michael L. A recellularized human colon model identifies cancer driver genes. Nature Biotechnology. 2016;34(8):845-51.  PubMed
Chen, Huanhuan Joyce; Poran, Asaf; Unni, Arun M; Huang, Sarah Xuelian; Elemento, Olivier; Snoeck, Hans-Willem; Varmus, Harold. Generation of pulmonary neuroendocrine cells and SCLC-like tumors from human embryonic stem cells. The Journal Of Experimental Medicine. 2019;216(3):674-687.  PubMed
Zhang, Dongyun; Babayan, Lilit; Ho, Hillary; Heaney, Anthony P. Chromogranin A regulates neuroblastoma proliferation and phenotype. Biology Open. 2019;8(3)  PubMed
Kiflemariam, Sara; Andersson, Sandra; Asplund, Anna; Pontén, Fredrik; Sjöblom, Tobias. Scalable in situ hybridization on tissue arrays for validation of novel cancer and tissue-specific biomarkers. Plos One. 7(3):e32927.  PubMed
Marbiah, Masue M; Harvey, Anna; West, Billy T; Louzolo, Anais; Banerjee, Priya; Alden, Jack; Grigoriadis, Anita; Hummerich, Holger; Kan, Ho-Man; Cai, Ying; Bloom, George S; Jat, Parmjit; Collinge, John; Klöhn, Peter-Christian. Identification of a gene regulatory network associated with prion replication. The Embo Journal. 2014;33(14):1527-47.  PubMed