Protein Description: chromodomain helicase DNA binding protein 9
Gene Name: CHD9
Alternative Gene Name: BC022889, FLJ12178, KIAA0308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056608: 72%, ENSRNOG00000049302: 69%
Entrez Gene ID: 80205
Uniprot ID: Q3L8U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHD9
Alternative Gene Name: BC022889, FLJ12178, KIAA0308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056608: 72%, ENSRNOG00000049302: 69%
Entrez Gene ID: 80205
Uniprot ID: Q3L8U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA |
| Documents & Links for Anti CHD9 pAb (ATL-HPA066155) | |
| Datasheet | Anti CHD9 pAb (ATL-HPA066155) Datasheet (External Link) |
| Vendor Page | Anti CHD9 pAb (ATL-HPA066155) at Atlas |
| Documents & Links for Anti CHD9 pAb (ATL-HPA066155) | |
| Datasheet | Anti CHD9 pAb (ATL-HPA066155) Datasheet (External Link) |
| Vendor Page | Anti CHD9 pAb (ATL-HPA066155) |