Description
Product Description
Protein Description: chromodomain helicase DNA binding protein 8
Gene Name: CHD8
Alternative Gene Name: DUPLIN, HELSNF1, KIAA1564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053754: 93%, ENSRNOG00000025011: 92%
Entrez Gene ID: 57680
Uniprot ID: Q9HCK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHD8
Alternative Gene Name: DUPLIN, HELSNF1, KIAA1564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053754: 93%, ENSRNOG00000025011: 92%
Entrez Gene ID: 57680
Uniprot ID: Q9HCK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGNSSASELVPPPEEAAPTELSKESTAPAPESITLHDYTTQPASQEQP |
Gene Sequence | LDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGNSSASELVPPPEEAAPTELSKESTAPAPESITLHDYTTQPASQEQP |
Gene ID - Mouse | ENSMUSG00000053754 |
Gene ID - Rat | ENSRNOG00000025011 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CHD8 pAb (ATL-HPA076133) | |
Datasheet | Anti CHD8 pAb (ATL-HPA076133) Datasheet (External Link) |
Vendor Page | Anti CHD8 pAb (ATL-HPA076133) at Atlas Antibodies |
Documents & Links for Anti CHD8 pAb (ATL-HPA076133) | |
Datasheet | Anti CHD8 pAb (ATL-HPA076133) Datasheet (External Link) |
Vendor Page | Anti CHD8 pAb (ATL-HPA076133) |