Anti CHD8 pAb (ATL-HPA076133)

Atlas Antibodies

Catalog No: ATL-HPA076133-25

• 

Product Description

Protein Description: chromodomain helicase DNA binding protein 8
Gene Name: CHD8
Alternative Gene Name: DUPLIN, HELSNF1, KIAA1564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053754: 93%, ENSRNOG00000025011: 92%
Entrez Gene ID: 57680
Uniprot ID: Q9HCK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGNSSASELVPPPEEAAPTELSKESTAPAPESITLHDYTTQPASQEQP
• Gene Sequence: LDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGNSSASELVPPPEEAAPTELSKESTAPAPESITLHDYTTQPASQEQP
• Gene ID - Mouse: ENSMUSG00000053754
• Gene ID - Rat: ENSRNOG00000025011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.