Description
Product Description
Protein Description: chromodomain helicase DNA binding protein 2
Gene Name: CHD2
Alternative Gene Name: DKFZp547I1315, DKFZp686E01200, DKFZp781D1727, FLJ38614
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078671: 88%, ENSRNOG00000012716: 90%
Entrez Gene ID: 1106
Uniprot ID: O14647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHD2
Alternative Gene Name: DKFZp547I1315, DKFZp686E01200, DKFZp781D1727, FLJ38614
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078671: 88%, ENSRNOG00000012716: 90%
Entrez Gene ID: 1106
Uniprot ID: O14647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VTGGEEAKLKKRKPRVKKENKVPRLKEEHGIELSSPRHSDNPSEEGEVKDDGLEKSPMKKKQKKKENKENKEKQMSSRKDKEGDKERKKSKD |
Gene Sequence | VTGGEEAKLKKRKPRVKKENKVPRLKEEHGIELSSPRHSDNPSEEGEVKDDGLEKSPMKKKQKKKENKENKEKQMSSRKDKEGDKERKKSKD |
Gene ID - Mouse | ENSMUSG00000078671 |
Gene ID - Rat | ENSRNOG00000012716 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CHD2 pAb (ATL-HPA060960) | |
Datasheet | Anti CHD2 pAb (ATL-HPA060960) Datasheet (External Link) |
Vendor Page | Anti CHD2 pAb (ATL-HPA060960) at Atlas Antibodies |
Documents & Links for Anti CHD2 pAb (ATL-HPA060960) | |
Datasheet | Anti CHD2 pAb (ATL-HPA060960) Datasheet (External Link) |
Vendor Page | Anti CHD2 pAb (ATL-HPA060960) |