Anti CGNL1 pAb (ATL-HPA069214)

Catalog No:
ATL-HPA069214-25
$303.00

Description

Product Description

Protein Description: cingulin-like 1
Gene Name: CGNL1
Alternative Gene Name: FLJ14957, JACOP, KIAA1749, paracingulin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032232: 85%, ENSRNOG00000054080: 85%
Entrez Gene ID: 84952
Uniprot ID: Q0VF96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLT
Gene Sequence NRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLT
Gene ID - Mouse ENSMUSG00000032232
Gene ID - Rat ENSRNOG00000054080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CGNL1 pAb (ATL-HPA069214)
Datasheet Anti CGNL1 pAb (ATL-HPA069214) Datasheet (External Link)
Vendor Page Anti CGNL1 pAb (ATL-HPA069214) at Atlas Antibodies

Documents & Links for Anti CGNL1 pAb (ATL-HPA069214)
Datasheet Anti CGNL1 pAb (ATL-HPA069214) Datasheet (External Link)
Vendor Page Anti CGNL1 pAb (ATL-HPA069214)

Product Description

Protein Description: cingulin-like 1
Gene Name: CGNL1
Alternative Gene Name: FLJ14957, JACOP, KIAA1749, paracingulin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032232: 85%, ENSRNOG00000054080: 85%
Entrez Gene ID: 84952
Uniprot ID: Q0VF96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLT
Gene Sequence NRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLT
Gene ID - Mouse ENSMUSG00000032232
Gene ID - Rat ENSRNOG00000054080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CGNL1 pAb (ATL-HPA069214)
Datasheet Anti CGNL1 pAb (ATL-HPA069214) Datasheet (External Link)
Vendor Page Anti CGNL1 pAb (ATL-HPA069214) at Atlas Antibodies

Documents & Links for Anti CGNL1 pAb (ATL-HPA069214)
Datasheet Anti CGNL1 pAb (ATL-HPA069214) Datasheet (External Link)
Vendor Page Anti CGNL1 pAb (ATL-HPA069214)