Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056911-25

• 
• 

Product Description

Protein Description: cingulin-like 1
Gene Name: CGNL1
Alternative Gene Name: FLJ14957, JACOP, KIAA1749, paracingulin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032232: 91%, ENSRNOG00000054080: 89%
Entrez Gene ID: 84952
Uniprot ID: Q0VF96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK
• Gene Sequence: NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK
• Gene ID - Mouse: ENSMUSG00000032232
• Gene ID - Rat: ENSRNOG00000054080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.