Polyclonal Antibody against Human CFAP99, Gene description: cilia and flagella associated protein 99, Validated applications: ICC, Uniprot ID: D6REC4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQ |
| Gene ID - Mouse | ENSMUSG00000109572 |
| Gene ID - Rat | ENSMUSG00000109572 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-CFAP99 pAb (ATL-HPA071642) | |
| Vendor Page | Anti-CFAP99 pAb (ATL-HPA071642) at Atlas |
| Documents & Links for Anti-CFAP99 pAb (ATL-HPA071642) | |
| Vendor Page | Anti-CFAP99 pAb (ATL-HPA071642) |