Anti-CFAP99 pAb (ATL-HPA071642)

Catalog No:
ATL-HPA071642-100
$596.00
Polyclonal Antibody against Human CFAP99, Gene description: cilia and flagella associated protein 99, Validated applications: ICC, Uniprot ID: D6REC4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence RLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQ
Gene ID - Mouse ENSMUSG00000109572
Gene ID - Rat ENSMUSG00000109572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-CFAP99 pAb (ATL-HPA071642)
Vendor Page Anti-CFAP99 pAb (ATL-HPA071642) at Atlas

Documents & Links for Anti-CFAP99 pAb (ATL-HPA071642)
Vendor Page Anti-CFAP99 pAb (ATL-HPA071642)