Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA074084-25

• 

Product Description

Protein Description: MYCBP associated and testis expressed 1
Gene Name: CFAP91
Alternative Gene Name: AAT1, AAT1alpha, C3orf15, CaM-IP2, SPATA26, MAATS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022805: 83%, ENSRNOG00000002976: 81%
Entrez Gene ID: 89876
Uniprot ID: Q7Z4T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT
• Gene Sequence: DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT
• Gene ID - Mouse: ENSMUSG00000022805
• Gene ID - Rat: ENSRNOG00000002976
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.