Protein Description: MYCBP associated and testis expressed 1
Gene Name: CFAP91
Alternative Gene Name: AAT1, AAT1alpha, C3orf15, CaM-IP2, SPATA26, MAATS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022805: 83%, ENSRNOG00000002976: 81%
Entrez Gene ID: 89876
Uniprot ID: Q7Z4T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP91
Alternative Gene Name: AAT1, AAT1alpha, C3orf15, CaM-IP2, SPATA26, MAATS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022805: 83%, ENSRNOG00000002976: 81%
Entrez Gene ID: 89876
Uniprot ID: Q7Z4T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT |
| Documents & Links for Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) | |
| Datasheet | Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) at Atlas |
| Documents & Links for Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) | |
| Datasheet | Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) |