Anti CFAP77 pAb (ATL-HPA061069 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061069-25

• 

Product Description

Protein Description: cilia and flagella associated protein 77
Gene Name: CFAP77
Alternative Gene Name: C9orf171, FLJ46082
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079502: 86%, ENSRNOG00000047642: 84%
Entrez Gene ID: 389799
Uniprot ID: Q6ZQR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKL
• Gene Sequence: AVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKL
• Gene ID - Mouse: ENSMUSG00000079502
• Gene ID - Rat: ENSRNOG00000047642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.