Anti CFAP70 pAb (ATL-HPA070304 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA070304-25

• 

Product Description

Protein Description: cilia and flagella associated protein 70
Gene Name: CFAP70
Alternative Gene Name: FLJ25765, TTC18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039543: 80%, ENSRNOG00000007046: 81%
Entrez Gene ID: 118491
Uniprot ID: Q5T0N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKE
• Gene Sequence: DLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKE
• Gene ID - Mouse: ENSMUSG00000039543
• Gene ID - Rat: ENSRNOG00000007046
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.