Protein Description: cilia and flagella associated protein 69
Gene Name: CFAP69
Alternative Gene Name: C7orf63, FAP69, FLJ21062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040473: 82%, ENSRNOG00000006114: 81%
Entrez Gene ID: 79846
Uniprot ID: A5D8W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP69
Alternative Gene Name: C7orf63, FAP69, FLJ21062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040473: 82%, ENSRNOG00000006114: 81%
Entrez Gene ID: 79846
Uniprot ID: A5D8W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA |
| Documents & Links for Anti CFAP69 pAb (ATL-HPA062883) | |
| Datasheet | Anti CFAP69 pAb (ATL-HPA062883) Datasheet (External Link) |
| Vendor Page | Anti CFAP69 pAb (ATL-HPA062883) at Atlas |
| Documents & Links for Anti CFAP69 pAb (ATL-HPA062883) | |
| Datasheet | Anti CFAP69 pAb (ATL-HPA062883) Datasheet (External Link) |
| Vendor Page | Anti CFAP69 pAb (ATL-HPA062883) |