Protein Description: cilia and flagella associated protein 65
Gene Name: CFAP65
Alternative Gene Name: CCDC108, DKFZp434O0527, MGC35338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047021: 77%, ENSRNOG00000056996: 81%
Entrez Gene ID: 255101
Uniprot ID: Q6ZU64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP65
Alternative Gene Name: CCDC108, DKFZp434O0527, MGC35338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047021: 77%, ENSRNOG00000056996: 81%
Entrez Gene ID: 255101
Uniprot ID: Q6ZU64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WTRRSDCPFWVTPESCDVPPLKSMAMRLHFQPPHPNCLYTVELEAFAIYKVLQSYSNIEEDCTMCPSWCLTVRARGHSYFAGFEHHIPQYSLDVPKLFP |
| Documents & Links for Anti CFAP65 pAb (ATL-HPA063406) | |
| Datasheet | Anti CFAP65 pAb (ATL-HPA063406) Datasheet (External Link) |
| Vendor Page | Anti CFAP65 pAb (ATL-HPA063406) at Atlas |
| Documents & Links for Anti CFAP65 pAb (ATL-HPA063406) | |
| Datasheet | Anti CFAP65 pAb (ATL-HPA063406) Datasheet (External Link) |
| Vendor Page | Anti CFAP65 pAb (ATL-HPA063406) |
| Citations for Anti CFAP65 pAb (ATL-HPA063406) – 1 Found |
| Martinez, Guillaume; Barbotin, Anne-Laure; Cazin, Caroline; Wehbe, Zeina; Boursier, Angèle; Amiri-Yekta, Amir; Daneshipour, Abbas; Hosseini, Seyedeh-Hanieh; Rives, Nathalie; Feraille, Aurélie; Thierry-Mieg, Nicolas; Bidart, Marie; Satre, Véronique; Arnoult, Christophe; Ray, Pierre F; Kherraf, Zine-Eddine; Coutton, Charles. New Mutations in DNHD1 Cause Multiple Morphological Abnormalities of the Sperm Flagella. International Journal Of Molecular Sciences. 2023;24(3) PubMed |