Anti CFAP61 pAb (ATL-HPA009079)

Atlas Antibodies

Catalog No: ATL-HPA009079-25

• 

Product Description

Protein Description: cilia and flagella associated protein 61
Gene Name: CFAP61
Alternative Gene Name: C20orf26, CaM-IP3, dJ1002M8.3, DKFZP434K156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037143: 79%, ENSRNOG00000050239: 17%
Entrez Gene ID: 26074
Uniprot ID: Q8NHU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE
• Gene Sequence: HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE
• Gene ID - Mouse: ENSMUSG00000037143
• Gene ID - Rat: ENSRNOG00000050239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti CFAP61 pAb (ATL-HPA009079) – 1 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.