Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA066142-25

• 

Product Description

Protein Description: cilia and flagella associated protein 53
Gene Name: CFAP53
Alternative Gene Name: CCDC11, FLJ32743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035394: 75%, ENSRNOG00000014585: 75%
Entrez Gene ID: 220136
Uniprot ID: Q96M91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD
• Gene Sequence: QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD
• Gene ID - Mouse: ENSMUSG00000035394
• Gene ID - Rat: ENSRNOG00000014585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.