Protein Description: cilia and flagella associated protein 53
Gene Name: CFAP53
Alternative Gene Name: CCDC11, FLJ32743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035394: 75%, ENSRNOG00000014585: 75%
Entrez Gene ID: 220136
Uniprot ID: Q96M91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP53
Alternative Gene Name: CCDC11, FLJ32743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035394: 75%, ENSRNOG00000014585: 75%
Entrez Gene ID: 220136
Uniprot ID: Q96M91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD |
| Documents & Links for Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation) | |
| Datasheet | Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation) at Atlas |
| Documents & Links for Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation) | |
| Datasheet | Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CFAP53 pAb (ATL-HPA066142 w/enhanced validation) |