Protein Description: cilia and flagella associated protein 206
Gene Name: CFAP206
Alternative Gene Name: C6orf165, dJ382I10.1, FLJ25974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028294: 70%, ENSRNOG00000009061: 70%
Entrez Gene ID: 154313
Uniprot ID: Q8IYR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP206
Alternative Gene Name: C6orf165, dJ382I10.1, FLJ25974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028294: 70%, ENSRNOG00000009061: 70%
Entrez Gene ID: 154313
Uniprot ID: Q8IYR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GVLSNLFTHIQPFLGAHELYFPERVMQCHLNGATVKTDVCRMKEHMEDRVNVADFRKLEWLFPETTANFDKLLIQYRGFCAYTFAATDGLLL |
Documents & Links for Anti CFAP206 pAb (ATL-HPA072261) | |
Datasheet | Anti CFAP206 pAb (ATL-HPA072261) Datasheet (External Link) |
Vendor Page | Anti CFAP206 pAb (ATL-HPA072261) at Atlas |
Documents & Links for Anti CFAP206 pAb (ATL-HPA072261) | |
Datasheet | Anti CFAP206 pAb (ATL-HPA072261) Datasheet (External Link) |
Vendor Page | Anti CFAP206 pAb (ATL-HPA072261) |