Anti CFAP206 pAb (ATL-HPA072261)

Catalog No:
ATL-HPA072261-25
$401.00
Protein Description: cilia and flagella associated protein 206
Gene Name: CFAP206
Alternative Gene Name: C6orf165, dJ382I10.1, FLJ25974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028294: 70%, ENSRNOG00000009061: 70%
Entrez Gene ID: 154313
Uniprot ID: Q8IYR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GVLSNLFTHIQPFLGAHELYFPERVMQCHLNGATVKTDVCRMKEHMEDRVNVADFRKLEWLFPETTANFDKLLIQYRGFCAYTFAATDGLLL

Documents & Links for Anti CFAP206 pAb (ATL-HPA072261)
Datasheet Anti CFAP206 pAb (ATL-HPA072261) Datasheet (External Link)
Vendor Page Anti CFAP206 pAb (ATL-HPA072261) at Atlas

Documents & Links for Anti CFAP206 pAb (ATL-HPA072261)
Datasheet Anti CFAP206 pAb (ATL-HPA072261) Datasheet (External Link)
Vendor Page Anti CFAP206 pAb (ATL-HPA072261)