Protein Description: cilia and flagella associated protein 161
Gene Name: CFAP161
Alternative Gene Name: C15orf26, FLJ38615
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011154: 73%, ENSRNOG00000012301: 74%
Entrez Gene ID: 161502
Uniprot ID: Q6P656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP161
Alternative Gene Name: C15orf26, FLJ38615
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011154: 73%, ENSRNOG00000012301: 74%
Entrez Gene ID: 161502
Uniprot ID: Q6P656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEI |
| Documents & Links for Anti CFAP161 pAb (ATL-HPA076975) | |
| Datasheet | Anti CFAP161 pAb (ATL-HPA076975) Datasheet (External Link) |
| Vendor Page | Anti CFAP161 pAb (ATL-HPA076975) at Atlas |
| Documents & Links for Anti CFAP161 pAb (ATL-HPA076975) | |
| Datasheet | Anti CFAP161 pAb (ATL-HPA076975) Datasheet (External Link) |
| Vendor Page | Anti CFAP161 pAb (ATL-HPA076975) |