Anti CFAP161 pAb (ATL-HPA076975)

Atlas Antibodies

Catalog No: ATL-HPA076975-25

• 

Product Description

Protein Description: cilia and flagella associated protein 161
Gene Name: CFAP161
Alternative Gene Name: C15orf26, FLJ38615
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011154: 73%, ENSRNOG00000012301: 74%
Entrez Gene ID: 161502
Uniprot ID: Q6P656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEI
• Gene Sequence: RIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEI
• Gene ID - Mouse: ENSMUSG00000011154
• Gene ID - Rat: ENSRNOG00000012301
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.