Protein Description: ceramide kinase
Gene Name: CERK
Alternative Gene Name: dA59H18.2, dA59H18.3, DKFZp434E0211, FLJ21430, FLJ23239, hCERK, KIAA1646, LK4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035891: 85%, ENSRNOG00000017022: 89%
Entrez Gene ID: 64781
Uniprot ID: Q8TCT0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CERK
Alternative Gene Name: dA59H18.2, dA59H18.3, DKFZp434E0211, FLJ21430, FLJ23239, hCERK, KIAA1646, LK4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035891: 85%, ENSRNOG00000017022: 89%
Entrez Gene ID: 64781
Uniprot ID: Q8TCT0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLL |
| Documents & Links for Anti CERK pAb (ATL-HPA064699) | |
| Datasheet | Anti CERK pAb (ATL-HPA064699) Datasheet (External Link) |
| Vendor Page | Anti CERK pAb (ATL-HPA064699) at Atlas |
| Documents & Links for Anti CERK pAb (ATL-HPA064699) | |
| Datasheet | Anti CERK pAb (ATL-HPA064699) Datasheet (External Link) |
| Vendor Page | Anti CERK pAb (ATL-HPA064699) |
| Citations for Anti CERK pAb (ATL-HPA064699) – 1 Found |
| Boi, Roberto; Ebefors, Kerstin; Henricsson, Marcus; Borén, Jan; Nyström, Jenny. Modified lipid metabolism and cytosolic phospholipase A2 activation in mesangial cells under pro-inflammatory conditions. Scientific Reports. 2022;12(1):7322. PubMed |