Anti CEP72 pAb (ATL-HPA074879)

Atlas Antibodies

Catalog No: ATL-HPA074879-25

• 

Product Description

Protein Description: centrosomal protein 72kDa
Gene Name: CEP72
Alternative Gene Name: FLJ10565, KIAA1519
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021572: 84%, ENSRNOG00000015465: 84%
Entrez Gene ID: 55722
Uniprot ID: Q9P209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKTMALF
• Gene Sequence: SVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKTMALF
• Gene ID - Mouse: ENSMUSG00000021572
• Gene ID - Rat: ENSRNOG00000015465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.