Anti CEP63 pAb (ATL-HPA058154)

Atlas Antibodies

Catalog No: ATL-HPA058154-25

• 

Product Description

Protein Description: centrosomal protein 63kDa
Gene Name: CEP63
Alternative Gene Name: FLJ13386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032534: 85%, ENSRNOG00000008410: 83%
Entrez Gene ID: 80254
Uniprot ID: Q96MT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
• Gene Sequence: LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
• Gene ID - Mouse: ENSMUSG00000032534
• Gene ID - Rat: ENSRNOG00000008410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.