Protein Description: centrosomal protein 290kDa
Gene Name: CEP290
Alternative Gene Name: 3H11Ag, BBS14, CT87, FLJ13615, JBTS5, KIAA0373, LCA10, MKS4, NPHP6, POC3, rd16, SLSN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019971: 92%, ENSRNOG00000056458: 93%
Entrez Gene ID: 80184
Uniprot ID: O15078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CEP290
Alternative Gene Name: 3H11Ag, BBS14, CT87, FLJ13615, JBTS5, KIAA0373, LCA10, MKS4, NPHP6, POC3, rd16, SLSN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019971: 92%, ENSRNOG00000056458: 93%
Entrez Gene ID: 80184
Uniprot ID: O15078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASII |
Documents & Links for Anti CEP290 pAb (ATL-HPA064397) | |
Datasheet | Anti CEP290 pAb (ATL-HPA064397) Datasheet (External Link) |
Vendor Page | Anti CEP290 pAb (ATL-HPA064397) at Atlas |
Documents & Links for Anti CEP290 pAb (ATL-HPA064397) | |
Datasheet | Anti CEP290 pAb (ATL-HPA064397) Datasheet (External Link) |
Vendor Page | Anti CEP290 pAb (ATL-HPA064397) |