Anti CEP19 pAb (ATL-HPA071138)

Catalog No:
ATL-HPA071138-25
$447.00

Description

Product Description

Protein Description: centrosomal protein 19kDa
Gene Name: CEP19
Alternative Gene Name: C3orf34, MGC14126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035790: 88%, ENSRNOG00000024924: 90%
Entrez Gene ID: 84984
Uniprot ID: Q96LK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
Gene Sequence QSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
Gene ID - Mouse ENSMUSG00000035790
Gene ID - Rat ENSRNOG00000024924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CEP19 pAb (ATL-HPA071138)
Datasheet Anti CEP19 pAb (ATL-HPA071138) Datasheet (External Link)
Vendor Page Anti CEP19 pAb (ATL-HPA071138) at Atlas Antibodies

Documents & Links for Anti CEP19 pAb (ATL-HPA071138)
Datasheet Anti CEP19 pAb (ATL-HPA071138) Datasheet (External Link)
Vendor Page Anti CEP19 pAb (ATL-HPA071138)

Product Description

Protein Description: centrosomal protein 19kDa
Gene Name: CEP19
Alternative Gene Name: C3orf34, MGC14126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035790: 88%, ENSRNOG00000024924: 90%
Entrez Gene ID: 84984
Uniprot ID: Q96LK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
Gene Sequence QSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
Gene ID - Mouse ENSMUSG00000035790
Gene ID - Rat ENSRNOG00000024924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CEP19 pAb (ATL-HPA071138)
Datasheet Anti CEP19 pAb (ATL-HPA071138) Datasheet (External Link)
Vendor Page Anti CEP19 pAb (ATL-HPA071138) at Atlas Antibodies

Documents & Links for Anti CEP19 pAb (ATL-HPA071138)
Datasheet Anti CEP19 pAb (ATL-HPA071138) Datasheet (External Link)
Vendor Page Anti CEP19 pAb (ATL-HPA071138)