Protein Description: centrosomal protein 19kDa
Gene Name: CEP19
Alternative Gene Name: C3orf34, MGC14126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035790: 88%, ENSRNOG00000024924: 90%
Entrez Gene ID: 84984
Uniprot ID: Q96LK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CEP19
Alternative Gene Name: C3orf34, MGC14126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035790: 88%, ENSRNOG00000024924: 90%
Entrez Gene ID: 84984
Uniprot ID: Q96LK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF |
Documents & Links for Anti CEP19 pAb (ATL-HPA071138) | |
Datasheet | Anti CEP19 pAb (ATL-HPA071138) Datasheet (External Link) |
Vendor Page | Anti CEP19 pAb (ATL-HPA071138) at Atlas |
Documents & Links for Anti CEP19 pAb (ATL-HPA071138) | |
Datasheet | Anti CEP19 pAb (ATL-HPA071138) Datasheet (External Link) |
Vendor Page | Anti CEP19 pAb (ATL-HPA071138) |