Anti CEP170B pAb (ATL-HPA059017 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA059017-25

• 

Product Description

Protein Description: centrosomal protein 170B
Gene Name: CEP170B
Alternative Gene Name: Cep170R, FAM68C, KIAA0284
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072825: 58%, ENSRNOG00000033688: 58%
Entrez Gene ID: 283638
Uniprot ID: Q9Y4F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPLRAQKEMSPSPPAAQDPGGTALVSAREQSSERQHHPLGPTDMGRGEPVRRSAIRRGHRPRGSLDWPSEERGPVLAHLPSSDVMASNHET
• Gene Sequence: QPLRAQKEMSPSPPAAQDPGGTALVSAREQSSERQHHPLGPTDMGRGEPVRRSAIRRGHRPRGSLDWPSEERGPVLAHLPSSDVMASNHET
• Gene ID - Mouse: ENSMUSG00000072825
• Gene ID - Rat: ENSRNOG00000033688
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.