Anti CENPW pAb (ATL-HPA067285)

Catalog No:
ATL-HPA067285-25
$303.00

Description

Product Description

Protein Description: centromere protein W
Gene Name: CENPW
Alternative Gene Name: C6orf173, CUG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075266: 59%, ENSRNOG00000042944: 62%
Entrez Gene ID: 387103
Uniprot ID: Q5EE01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK
Gene Sequence MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK
Gene ID - Mouse ENSMUSG00000075266
Gene ID - Rat ENSRNOG00000042944
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CENPW pAb (ATL-HPA067285)
Datasheet Anti CENPW pAb (ATL-HPA067285) Datasheet (External Link)
Vendor Page Anti CENPW pAb (ATL-HPA067285) at Atlas Antibodies

Documents & Links for Anti CENPW pAb (ATL-HPA067285)
Datasheet Anti CENPW pAb (ATL-HPA067285) Datasheet (External Link)
Vendor Page Anti CENPW pAb (ATL-HPA067285)

Product Description

Protein Description: centromere protein W
Gene Name: CENPW
Alternative Gene Name: C6orf173, CUG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075266: 59%, ENSRNOG00000042944: 62%
Entrez Gene ID: 387103
Uniprot ID: Q5EE01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK
Gene Sequence MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK
Gene ID - Mouse ENSMUSG00000075266
Gene ID - Rat ENSRNOG00000042944
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CENPW pAb (ATL-HPA067285)
Datasheet Anti CENPW pAb (ATL-HPA067285) Datasheet (External Link)
Vendor Page Anti CENPW pAb (ATL-HPA067285) at Atlas Antibodies

Documents & Links for Anti CENPW pAb (ATL-HPA067285)
Datasheet Anti CENPW pAb (ATL-HPA067285) Datasheet (External Link)
Vendor Page Anti CENPW pAb (ATL-HPA067285)