Anti CENPP pAb (ATL-HPA058945)

Atlas Antibodies

Catalog No: ATL-HPA058945-25

• 

Product Description

Protein Description: centromere protein P
Gene Name: CENPP
Alternative Gene Name: CENP-P, RP11-19J3.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021391: 76%, ENSRNOG00000062220: 77%
Entrez Gene ID: 401541
Uniprot ID: Q6IPU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELD
• Gene Sequence: KHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELD
• Gene ID - Mouse: ENSMUSG00000021391
• Gene ID - Rat: ENSRNOG00000062220
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.