Description
Product Description
Protein Description: centromere protein I
Gene Name: CENPI
Alternative Gene Name: CENP-I, FSHPRH1, LRPR1, Mis6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031262: 64%, ENSRNOG00000033335: 65%
Entrez Gene ID: 2491
Uniprot ID: Q92674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CENPI
Alternative Gene Name: CENP-I, FSHPRH1, LRPR1, Mis6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031262: 64%, ENSRNOG00000033335: 65%
Entrez Gene ID: 2491
Uniprot ID: Q92674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN |
Gene Sequence | PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN |
Gene ID - Mouse | ENSMUSG00000031262 |
Gene ID - Rat | ENSRNOG00000033335 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CENPI pAb (ATL-HPA061297) | |
Datasheet | Anti CENPI pAb (ATL-HPA061297) Datasheet (External Link) |
Vendor Page | Anti CENPI pAb (ATL-HPA061297) at Atlas Antibodies |
Documents & Links for Anti CENPI pAb (ATL-HPA061297) | |
Datasheet | Anti CENPI pAb (ATL-HPA061297) Datasheet (External Link) |
Vendor Page | Anti CENPI pAb (ATL-HPA061297) |