Protein Description: centromere protein F
Gene Name: CENPF
Alternative Gene Name: hcp-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026605: 63%, ENSRNOG00000003388: 65%
Entrez Gene ID: 1063
Uniprot ID: P49454
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CENPF
Alternative Gene Name: hcp-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026605: 63%, ENSRNOG00000003388: 65%
Entrez Gene ID: 1063
Uniprot ID: P49454
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL |
| Documents & Links for Anti CENPF pAb (ATL-HPA064308 w/enhanced validation) | |
| Datasheet | Anti CENPF pAb (ATL-HPA064308 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CENPF pAb (ATL-HPA064308 w/enhanced validation) at Atlas |
| Documents & Links for Anti CENPF pAb (ATL-HPA064308 w/enhanced validation) | |
| Datasheet | Anti CENPF pAb (ATL-HPA064308 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CENPF pAb (ATL-HPA064308 w/enhanced validation) |