Protein Description: CCAAT/enhancer binding protein (C/EBP), delta
Gene Name: CEBPD
Alternative Gene Name: C/EBP-delta, CELF, CRP3, NF-IL6-beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071637: 93%, ENSRNOG00000050869: 91%
Entrez Gene ID: 1052
Uniprot ID: P49716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CEBPD
Alternative Gene Name: C/EBP-delta, CELF, CRP3, NF-IL6-beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071637: 93%, ENSRNOG00000050869: 91%
Entrez Gene ID: 1052
Uniprot ID: P49716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR |
Documents & Links for Anti CEBPD pAb (ATL-HPA067581) | |
Datasheet | Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link) |
Vendor Page | Anti CEBPD pAb (ATL-HPA067581) at Atlas |
Documents & Links for Anti CEBPD pAb (ATL-HPA067581) | |
Datasheet | Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link) |
Vendor Page | Anti CEBPD pAb (ATL-HPA067581) |