Anti CEBPD pAb (ATL-HPA067581)

Catalog No:
ATL-HPA067581-25
$303.00

Description

Product Description

Protein Description: CCAAT/enhancer binding protein (C/EBP), delta
Gene Name: CEBPD
Alternative Gene Name: C/EBP-delta, CELF, CRP3, NF-IL6-beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071637: 93%, ENSRNOG00000050869: 91%
Entrez Gene ID: 1052
Uniprot ID: P49716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Gene Sequence AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Gene ID - Mouse ENSMUSG00000071637
Gene ID - Rat ENSRNOG00000050869
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CEBPD pAb (ATL-HPA067581)
Datasheet Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link)
Vendor Page Anti CEBPD pAb (ATL-HPA067581) at Atlas Antibodies

Documents & Links for Anti CEBPD pAb (ATL-HPA067581)
Datasheet Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link)
Vendor Page Anti CEBPD pAb (ATL-HPA067581)

Product Description

Protein Description: CCAAT/enhancer binding protein (C/EBP), delta
Gene Name: CEBPD
Alternative Gene Name: C/EBP-delta, CELF, CRP3, NF-IL6-beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071637: 93%, ENSRNOG00000050869: 91%
Entrez Gene ID: 1052
Uniprot ID: P49716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Gene Sequence AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Gene ID - Mouse ENSMUSG00000071637
Gene ID - Rat ENSRNOG00000050869
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CEBPD pAb (ATL-HPA067581)
Datasheet Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link)
Vendor Page Anti CEBPD pAb (ATL-HPA067581) at Atlas Antibodies

Documents & Links for Anti CEBPD pAb (ATL-HPA067581)
Datasheet Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link)
Vendor Page Anti CEBPD pAb (ATL-HPA067581)