Protein Description: carcinoembryonic antigen-related cell adhesion molecule 7
Gene Name: CEACAM7
Alternative Gene Name: CEA, CGM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063305: 47%, ENSRNOG00000042250: 43%
Entrez Gene ID: 1087
Uniprot ID: Q14002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CEACAM7
Alternative Gene Name: CEA, CGM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063305: 47%, ENSRNOG00000042250: 43%
Entrez Gene ID: 1087
Uniprot ID: Q14002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RVHANYRIIGYVKNISQENAPGPAHNGRET |
Documents & Links for Anti CEACAM7 pAb (ATL-HPA069621) | |
Datasheet | Anti CEACAM7 pAb (ATL-HPA069621) Datasheet (External Link) |
Vendor Page | Anti CEACAM7 pAb (ATL-HPA069621) at Atlas |
Documents & Links for Anti CEACAM7 pAb (ATL-HPA069621) | |
Datasheet | Anti CEACAM7 pAb (ATL-HPA069621) Datasheet (External Link) |
Vendor Page | Anti CEACAM7 pAb (ATL-HPA069621) |