Anti CEACAM7 pAb (ATL-HPA069621)

Atlas Antibodies

Catalog No: ATL-HPA069621-25

• 

Product Description

Protein Description: carcinoembryonic antigen-related cell adhesion molecule 7
Gene Name: CEACAM7
Alternative Gene Name: CEA, CGM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063305: 47%, ENSRNOG00000042250: 43%
Entrez Gene ID: 1087
Uniprot ID: Q14002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVHANYRIIGYVKNISQENAPGPAHNGRET
• Gene Sequence: RVHANYRIIGYVKNISQENAPGPAHNGRET
• Gene ID - Mouse: ENSMUSG00000063305
• Gene ID - Rat: ENSRNOG00000042250
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.