Description
Product Description
Protein Description: carcinoembryonic antigen-related cell adhesion molecule 18
Gene Name: CEACAM18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030472: 55%, ENSRNOG00000022701: 55%
Entrez Gene ID:
Uniprot ID: A8MTB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CEACAM18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030472: 55%, ENSRNOG00000022701: 55%
Entrez Gene ID:
Uniprot ID: A8MTB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL |
Gene Sequence | TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL |
Gene ID - Mouse | ENSMUSG00000030472 |
Gene ID - Rat | ENSRNOG00000022701 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CEACAM18 pAb (ATL-HPA059487) | |
Datasheet | Anti CEACAM18 pAb (ATL-HPA059487) Datasheet (External Link) |
Vendor Page | Anti CEACAM18 pAb (ATL-HPA059487) at Atlas Antibodies |
Documents & Links for Anti CEACAM18 pAb (ATL-HPA059487) | |
Datasheet | Anti CEACAM18 pAb (ATL-HPA059487) Datasheet (External Link) |
Vendor Page | Anti CEACAM18 pAb (ATL-HPA059487) |