Anti CEACAM18 pAb (ATL-HPA059487)

Catalog No:
ATL-HPA059487-100
$596.00

Description

Product Description

Protein Description: carcinoembryonic antigen-related cell adhesion molecule 18
Gene Name: CEACAM18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030472: 55%, ENSRNOG00000022701: 55%
Entrez Gene ID:
Uniprot ID: A8MTB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL
Gene Sequence TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL
Gene ID - Mouse ENSMUSG00000030472
Gene ID - Rat ENSRNOG00000022701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CEACAM18 pAb (ATL-HPA059487)
Datasheet Anti CEACAM18 pAb (ATL-HPA059487) Datasheet (External Link)
Vendor Page Anti CEACAM18 pAb (ATL-HPA059487) at Atlas Antibodies

Documents & Links for Anti CEACAM18 pAb (ATL-HPA059487)
Datasheet Anti CEACAM18 pAb (ATL-HPA059487) Datasheet (External Link)
Vendor Page Anti CEACAM18 pAb (ATL-HPA059487)

Product Description

Protein Description: carcinoembryonic antigen-related cell adhesion molecule 18
Gene Name: CEACAM18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030472: 55%, ENSRNOG00000022701: 55%
Entrez Gene ID:
Uniprot ID: A8MTB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL
Gene Sequence TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL
Gene ID - Mouse ENSMUSG00000030472
Gene ID - Rat ENSRNOG00000022701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CEACAM18 pAb (ATL-HPA059487)
Datasheet Anti CEACAM18 pAb (ATL-HPA059487) Datasheet (External Link)
Vendor Page Anti CEACAM18 pAb (ATL-HPA059487) at Atlas Antibodies

Documents & Links for Anti CEACAM18 pAb (ATL-HPA059487)
Datasheet Anti CEACAM18 pAb (ATL-HPA059487) Datasheet (External Link)
Vendor Page Anti CEACAM18 pAb (ATL-HPA059487)