Description
Product Description
Protein Description: chromodomain Y-linked 2B
Gene Name: CDY2B
Alternative Gene Name: CDY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059288: 38%, ENSRNOG00000032215: 41%
Entrez Gene ID: 203611
Uniprot ID: Q9Y6F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDY2B
Alternative Gene Name: CDY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059288: 38%, ENSRNOG00000032215: 41%
Entrez Gene ID: 203611
Uniprot ID: Q9Y6F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP |
Gene Sequence | RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP |
Gene ID - Mouse | ENSMUSG00000059288 |
Gene ID - Rat | ENSRNOG00000032215 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CDY2B pAb (ATL-HPA066682) | |
Datasheet | Anti CDY2B pAb (ATL-HPA066682) Datasheet (External Link) |
Vendor Page | Anti CDY2B pAb (ATL-HPA066682) at Atlas Antibodies |
Documents & Links for Anti CDY2B pAb (ATL-HPA066682) | |
Datasheet | Anti CDY2B pAb (ATL-HPA066682) Datasheet (External Link) |
Vendor Page | Anti CDY2B pAb (ATL-HPA066682) |