Anti CDR1 pAb (ATL-HPA073147)

Atlas Antibodies

Catalog No: ATL-HPA073147-25

• 

Product Description

Protein Description: cerebellar degeneration-related protein 1, 34kDa
Gene Name: CDR1
Alternative Gene Name: CDR, CDR34, CDR62A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090546: 57%, ENSRNOG00000038322: 33%
Entrez Gene ID: 1038
Uniprot ID: P51861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGF
• Gene Sequence: SEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGF
• Gene ID - Mouse: ENSMUSG00000090546
• Gene ID - Rat: ENSRNOG00000038322
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.