Protein Description: cerebellar degeneration-related protein 1, 34kDa
Gene Name: CDR1
Alternative Gene Name: CDR, CDR34, CDR62A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090546: 57%, ENSRNOG00000038322: 33%
Entrez Gene ID: 1038
Uniprot ID: P51861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDR1
Alternative Gene Name: CDR, CDR34, CDR62A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090546: 57%, ENSRNOG00000038322: 33%
Entrez Gene ID: 1038
Uniprot ID: P51861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGF |
| Documents & Links for Anti CDR1 pAb (ATL-HPA073147) | |
| Datasheet | Anti CDR1 pAb (ATL-HPA073147) Datasheet (External Link) |
| Vendor Page | Anti CDR1 pAb (ATL-HPA073147) at Atlas |
| Documents & Links for Anti CDR1 pAb (ATL-HPA073147) | |
| Datasheet | Anti CDR1 pAb (ATL-HPA073147) Datasheet (External Link) |
| Vendor Page | Anti CDR1 pAb (ATL-HPA073147) |