Protein Description: cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Gene Name: CDKN2B
Alternative Gene Name: CDK4I, INK4B, MTS2, P15, p15INK4b, TP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073802: 59%, ENSRNOG00000006735: 62%
Entrez Gene ID: 1030
Uniprot ID: P42772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDKN2B
Alternative Gene Name: CDK4I, INK4B, MTS2, P15, p15INK4b, TP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073802: 59%, ENSRNOG00000006735: 62%
Entrez Gene ID: 1030
Uniprot ID: P42772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG |
| Documents & Links for Anti CDKN2B pAb (ATL-HPA063327) | |
| Datasheet | Anti CDKN2B pAb (ATL-HPA063327) Datasheet (External Link) |
| Vendor Page | Anti CDKN2B pAb (ATL-HPA063327) at Atlas |
| Documents & Links for Anti CDKN2B pAb (ATL-HPA063327) | |
| Datasheet | Anti CDKN2B pAb (ATL-HPA063327) Datasheet (External Link) |
| Vendor Page | Anti CDKN2B pAb (ATL-HPA063327) |