Anti CDKN2AIP pAb (ATL-HPA062142)

Atlas Antibodies

Catalog No: ATL-HPA062142-25

• 

Product Description

Protein Description: CDKN2A interacting protein
Gene Name: CDKN2AIP
Alternative Gene Name: CARF, FLJ20036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038069: 90%, ENSRNOG00000022736: 91%
Entrez Gene ID: 55602
Uniprot ID: Q9NXV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK
• Gene Sequence: WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK
• Gene ID - Mouse: ENSMUSG00000038069
• Gene ID - Rat: ENSRNOG00000022736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.