Protein Description: cyclin-dependent kinase-like 4
Gene Name: CDKL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033966: 84%, ENSRNOG00000040266: 80%
Entrez Gene ID: 344387
Uniprot ID: Q5MAI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDKL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033966: 84%, ENSRNOG00000040266: 80%
Entrez Gene ID: 344387
Uniprot ID: Q5MAI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDS |
Documents & Links for Anti CDKL4 pAb (ATL-HPA067895) | |
Datasheet | Anti CDKL4 pAb (ATL-HPA067895) Datasheet (External Link) |
Vendor Page | Anti CDKL4 pAb (ATL-HPA067895) at Atlas |
Documents & Links for Anti CDKL4 pAb (ATL-HPA067895) | |
Datasheet | Anti CDKL4 pAb (ATL-HPA067895) Datasheet (External Link) |
Vendor Page | Anti CDKL4 pAb (ATL-HPA067895) |