![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/98068/177110/atl-hpa059605_anti-cdkl1-pab-atl-hpa059605_58769__11320.1681132263.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4")
Description
Product Description
Protein Description: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Gene Name: CDKL1
Alternative Gene Name: KKIALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020990: 90%, ENSRNOG00000038720: 90%
Entrez Gene ID: 8814
Uniprot ID: Q00532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDKL1
Alternative Gene Name: KKIALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020990: 90%, ENSRNOG00000038720: 90%
Entrez Gene ID: 8814
Uniprot ID: Q00532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK |
| Gene Sequence | RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK |
| Gene ID - Mouse | ENSMUSG00000020990 |
| Gene ID - Rat | ENSRNOG00000038720 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti CDKL1 pAb (ATL-HPA059605) | |
| Datasheet | Anti CDKL1 pAb (ATL-HPA059605) Datasheet (External Link) |
| Vendor Page | Anti CDKL1 pAb (ATL-HPA059605) at Atlas Antibodies |
| Documents & Links for Anti CDKL1 pAb (ATL-HPA059605) | |
| Datasheet | Anti CDKL1 pAb (ATL-HPA059605) Datasheet (External Link) |
| Vendor Page | Anti CDKL1 pAb (ATL-HPA059605) |