Protein Description: CDK5 regulatory subunit associated protein 1
Gene Name: CDK5RAP1
Alternative Gene Name: C20orf34, C42, CGI-05, HSPC167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027487: 89%, ENSRNOG00000015696: 86%
Entrez Gene ID: 51654
Uniprot ID: Q96SZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK5RAP1
Alternative Gene Name: C20orf34, C42, CGI-05, HSPC167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027487: 89%, ENSRNOG00000015696: 86%
Entrez Gene ID: 51654
Uniprot ID: Q96SZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS |
Documents & Links for Anti CDK5RAP1 pAb (ATL-HPA066301) | |
Datasheet | Anti CDK5RAP1 pAb (ATL-HPA066301) Datasheet (External Link) |
Vendor Page | Anti CDK5RAP1 pAb (ATL-HPA066301) at Atlas |
Documents & Links for Anti CDK5RAP1 pAb (ATL-HPA066301) | |
Datasheet | Anti CDK5RAP1 pAb (ATL-HPA066301) Datasheet (External Link) |
Vendor Page | Anti CDK5RAP1 pAb (ATL-HPA066301) |