Protein Description: cyclin-dependent kinase 5
Gene Name: CDK5
Alternative Gene Name: PSSALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028969: 99%, ENSRNOG00000008017: 99%
Entrez Gene ID: 1020
Uniprot ID: Q00535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK5
Alternative Gene Name: PSSALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028969: 99%, ENSRNOG00000008017: 99%
Entrez Gene ID: 1020
Uniprot ID: Q00535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCP |
Documents & Links for Anti CDK5 pAb (ATL-HPA064535 w/enhanced validation) | |
Datasheet | Anti CDK5 pAb (ATL-HPA064535 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDK5 pAb (ATL-HPA064535 w/enhanced validation) at Atlas |
Documents & Links for Anti CDK5 pAb (ATL-HPA064535 w/enhanced validation) | |
Datasheet | Anti CDK5 pAb (ATL-HPA064535 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDK5 pAb (ATL-HPA064535 w/enhanced validation) |