Protein Description: cyclin-dependent kinase 2 associated protein 1
Gene Name: CDK2AP1
Alternative Gene Name: doc-1, DOC1, DORC1, p12DOC-1, ST19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078154: 93%, ENSRNOG00000001070: 93%
Entrez Gene ID: 8099
Uniprot ID: O14519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK2AP1
Alternative Gene Name: doc-1, DOC1, DORC1, p12DOC-1, ST19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078154: 93%, ENSRNOG00000001070: 93%
Entrez Gene ID: 8099
Uniprot ID: O14519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MSYKPNLAAHMPAAALNAAGSVHSPSTSMA |
| Documents & Links for Anti CDK2AP1 pAb (ATL-HPA068833) | |
| Datasheet | Anti CDK2AP1 pAb (ATL-HPA068833) Datasheet (External Link) |
| Vendor Page | Anti CDK2AP1 pAb (ATL-HPA068833) at Atlas |
| Documents & Links for Anti CDK2AP1 pAb (ATL-HPA068833) | |
| Datasheet | Anti CDK2AP1 pAb (ATL-HPA068833) Datasheet (External Link) |
| Vendor Page | Anti CDK2AP1 pAb (ATL-HPA068833) |