Description
Product Description
Protein Description: cyclin-dependent kinase 2
Gene Name: CDK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025358: 100%, ENSRNOG00000006469: 100%
Entrez Gene ID: 1017
Uniprot ID: P24941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025358: 100%, ENSRNOG00000006469: 100%
Entrez Gene ID: 1017
Uniprot ID: P24941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS |
| Gene Sequence | PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS |
| Gene ID - Mouse | ENSMUSG00000025358 |
| Gene ID - Rat | ENSRNOG00000006469 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti CDK2 pAb (ATL-HPA066915) | |
| Datasheet | Anti CDK2 pAb (ATL-HPA066915) Datasheet (External Link) |
| Vendor Page | Anti CDK2 pAb (ATL-HPA066915) at Atlas Antibodies |
| Documents & Links for Anti CDK2 pAb (ATL-HPA066915) | |
| Datasheet | Anti CDK2 pAb (ATL-HPA066915) Datasheet (External Link) |
| Vendor Page | Anti CDK2 pAb (ATL-HPA066915) |