![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/101098/181146/atl-hpa073305_anti-cdk12-pab-atl-hpa073305_62814__10462.1681137405.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101098/181146/atl-hpa073305_anti-cdk12-pab-atl-hpa073305_62814__10462.1681137405.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: cyclin dependent kinase 12
Gene Name: CDK12
Alternative Gene Name: CRK7, CRKR, CRKRS, KIAA0904
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003119: 70%, ENSRNOG00000006000: 76%
Entrez Gene ID: 51755
Uniprot ID: Q9NYV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK12
Alternative Gene Name: CRK7, CRKR, CRKRS, KIAA0904
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003119: 70%, ENSRNOG00000006000: 76%
Entrez Gene ID: 51755
Uniprot ID: Q9NYV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KESKGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGT |
| Documents & Links for Anti CDK12 pAb (ATL-HPA073305) | |
| Datasheet | Anti CDK12 pAb (ATL-HPA073305) Datasheet (External Link) |
| Vendor Page | Anti CDK12 pAb (ATL-HPA073305) at Atlas |
| Documents & Links for Anti CDK12 pAb (ATL-HPA073305) | |
| Datasheet | Anti CDK12 pAb (ATL-HPA073305) Datasheet (External Link) |
| Vendor Page | Anti CDK12 pAb (ATL-HPA073305) |