Protein Description: cyclin-dependent kinase 11A
Gene Name: CDK11A
Alternative Gene Name: CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, p58GTA, PITSLRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029062: 97%, ENSRNOG00000017213: 97%
Entrez Gene ID: 728642
Uniprot ID: Q9UQ88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK11A
Alternative Gene Name: CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, p58GTA, PITSLRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029062: 97%, ENSRNOG00000017213: 97%
Entrez Gene ID: 728642
Uniprot ID: Q9UQ88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL |
| Documents & Links for Anti CDK11A pAb (ATL-HPA073626) | |
| Datasheet | Anti CDK11A pAb (ATL-HPA073626) Datasheet (External Link) |
| Vendor Page | Anti CDK11A pAb (ATL-HPA073626) at Atlas |
| Documents & Links for Anti CDK11A pAb (ATL-HPA073626) | |
| Datasheet | Anti CDK11A pAb (ATL-HPA073626) Datasheet (External Link) |
| Vendor Page | Anti CDK11A pAb (ATL-HPA073626) |